PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma44g00270.1
Common NameZOSMA_44G00270
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family EIL
Protein Properties Length: 501aa    MW: 58232.7 Da    PI: 6.7434
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma44g00270.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3430.61.5e-131443901353
                      XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXX....................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
             EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksn....................ksneqarrkkmsraQDgiLkYMlkemevcnaqGfvY 74 
                      +el++rmwkd+m+l+rlke+k+++++++++++++kk++                    +s++qarrk msraQDgiLkYMlk++evcna+GfvY
  Zosma44g00270.1  44 DELERRMWKDRMRLRRLKEQKRRETQNRKKNINTKKKKnqcetdnenettevvtqkneQSKDQARRKMMSRAQDGILKYMLKMVEVCNAKGFVY 137
                      79***********************999999887777778****************************************************** PP

                      XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT-- CS
             EIN3  75 giipekgkpvegasdsLraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgv 168
                      giipekgkpv+gasd+Lr+WWk+ v+fdrngp  iskyq+++ ++  ++   +++ s++ +l+elqDTtlgSLLsalmqhcdppqrrfplekgv
  Zosma44g00270.1 138 GIIPEKGKPVSGASDNLRGWWKDMVRFDRNGPDVISKYQSEHKLSRVNDVIMSSSVSTPRTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGV 231
                      *********************************************99999989999************************************** PP

                      HHHH---S--HHHHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXX CS
             EIN3 169 epPWWPtGkelwwgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsa 262
                      +pPWWP+G+e+ww+ lg++k+qg+ppykkphdlkk wkvsvLtavikhm p+i++ir+l+rqsk+lqdkm+akes ++l+v+nqe+ + +++s 
  Zosma44g00270.1 232 PPPWWPNGNEEWWPLLGIPKEQGAPPYKKPHDLKKLWKVSVLTAVIKHMTPDISKIRRLVRQSKCLQDKMTAKESGTWLAVINQED-LSRKLSH 324
                      ***********************************************************************************995.5555544 PP

                      XXXXXXXXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
             EIN3 263 hssslrkqspkvtlsceqkedvegkkeskikhvqavkttagfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                       +            sc  +     ++++k           +++++rkr++ p+ +++  ++  ++tc ++++++++++l+f+dkn +++++
  Zosma44g00270.1 325 PP---------PSSSCTGE-GI--DDDRK-----------SIDFIRKRQSAPEGDEQQRES--IYTCPNENCPHHDYQLGFHDKNLRNNHQ 390
                      44.........33455533.22..22233...........589*****9888888887655..7*************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048735.7E-12444317No hitNo description
Gene3DG3DSA:1.10.3180.109.6E-71191319IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167683.4E-59197318IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0042742Biological Processdefense response to bacterium
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    Send to blast
MEDVCFSDDL DFAQLPVNTS FPACNDPEMM GNDEESEKEE IEVDELERRM WKDRMRLRRL  60
KEQKRRETQN RKKNINTKKK KNQCETDNEN ETTEVVTQKN EQSKDQARRK MMSRAQDGIL  120
KYMLKMVEVC NAKGFVYGII PEKGKPVSGA SDNLRGWWKD MVRFDRNGPD VISKYQSEHK  180
LSRVNDVIMS SSVSTPRTLQ ELQDTTLGSL LSALMQHCDP PQRRFPLEKG VPPPWWPNGN  240
EEWWPLLGIP KEQGAPPYKK PHDLKKLWKV SVLTAVIKHM TPDISKIRRL VRQSKCLQDK  300
MTAKESGTWL AVINQEDLSR KLSHPPPSSS CTGEGIDDDR KSIDFIRKRQ SAPEGDEQQR  360
ESIYTCPNEN CPHHDYQLGF HDKNLRNNHQ FSCSLSPPTT NTFQMMEDKP SVFQNPHDVV  420
PFSLMISGDD RKKMDIDELM IYYDTHHNHH QLQQEPPKFQ IPDDMFLGSF ENQSGYMNCP  480
DLRYDSPFNL TKQDGCNWFY *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A9e-751943221130Protein ETHYLENE INSENSITIVE 3
4zds_B9e-751943221130Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15965LKEQKRR
26380KRRETQNRKKNINTKKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010243659.11e-155PREDICTED: protein ETHYLENE INSENSITIVE 3-like
SwissprotQ9SLH01e-146EIL1_ARATH; ETHYLENE INSENSITIVE 3-like 1 protein
TrEMBLA0A0K9P3410.0A0A0K9P341_Z
STRINGGSMUA_Achr6P15930_0011e-158(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63838168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27050.11e-118ETHYLENE-INSENSITIVE3-like 1